DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hil and crip2

DIOPT Version :9

Sequence 1:	NP_611493.2	Gene:	Hil / 37328	FlyBaseID:	FBgn0050147	Length:	818	Species:	Drosophila melanogaster
Sequence 2:	NP_998662.2	Gene:	crip2 / 554826	ZFINID:	ZDB-GENE-040426-2889	Length:	206	Species:	Danio rerio

Alignment Length:	132	Identity:	38/132 - (28%)
Similarity:	47/132 - (35%)	Gaps:	44/132 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 STCLRCSETVYQVDRVGPL-KDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPK 72
            |.|.:|.:|||..::|..| ||   :|..|.||..|...||.     ..|.:.|.:.||  |.|
Zfish     3 SKCPKCEKTVYFAEKVSSLGKD---WHKFCLKCERCSKTLTA-----GGHAEHDGKPYC--HKP- 56

  Fly    73 SGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGGPLGGSRQSTPNGYGSREISSPSQND 137
                        ...||..|   |.||  |.|..|.|...|..               :||..|:
Zfish    57 ------------CYAALFGP---KGVN--IGGAGSYVYEAPTN---------------TSPPPNN 89

  Fly   138 SD 139
            .|
Zfish    90 GD 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hil	NP_611493.2	LIM_Ltd-1	11..70	CDD:188827	20/59 (34%)
		BAR	<147..>265	CDD:299863
		TGc	418..486	CDD:214673
crip2	NP_998662.2	LIM1_TLP	5..58	CDD:188860	22/75 (29%)
crip2	NP_998662.2	LIM_TLP_like	124..177	CDD:188785
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810