DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and crip1

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001153291.1 Gene:crip1 / 541319 ZFINID:ZDB-GENE-041111-1 Length:77 Species:Danio rerio


Alignment Length:59 Identity:19/59 - (32%)
Similarity:28/59 - (47%) Gaps:9/59 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPL-KDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSS 68
            |.:|.:.||..:||..| ||   :|..|.||..|.     ||.....|.:.:.:.||::
Zfish     4 CPKCQKEVYFAERVTSLGKD---WHRPCLKCEKCN-----KTLSAGSHAEHEGKPYCNN 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 19/59 (32%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
crip1NP_001153291.1 LIM_CRIP 4..57 CDD:188862 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.