DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Mlp84B

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_477122.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:124 Identity:36/124 - (29%)
Similarity:53/124 - (42%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSS-HVPKSG 74
            |.||.::||..:.  .|.....||..||||..|.     |:..:....:.::|:||.: |..|.|
  Fly    12 CPRCGKSVYAAEE--RLAGGYVFHKNCFKCGMCN-----KSLDSTNCTEHERELYCKTCHGRKFG 69

  Fly    75 P-GHLDQTSVGIRQALNAPRTNKFVNE-----QIR-GTRSEVDGGPLGGSRQSTPNGYG 126
            | |:...|..|   .|:....::|:.|     .:| |.|.|    |...:|  .|.|.|
  Fly    70 PKGYGFGTGAG---TLSMDNGSQFLRENGDVPSVRNGARLE----PRAIAR--APEGEG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 17/59 (29%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
Mlp84BNP_477122.1 LIM1_MLP84B_like 11..64 CDD:188788 17/58 (29%)
LIM_CRP_like 120..173 CDD:188712 36/124 (29%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.