DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Mlp84B

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:124 Identity:36/124 - (29%)
Similarity:53/124 - (42%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSS-HVPKSG 74
            |.||.::||..:.  .|.....||..||||..|.     |:..:....:.::|:||.: |..|.|
  Fly    12 CPRCGKSVYAAEE--RLAGGYVFHKNCFKCGMCN-----KSLDSTNCTEHERELYCKTCHGRKFG 69

  Fly    75 P-GHLDQTSVGIRQALNAPRTNKFVNE-----QIR-GTRSEVDGGPLGGSRQSTPNGYG 126
            | |:...|..|   .|:....::|:.|     .:| |.|.|    |...:|  .|.|.|
  Fly    70 PKGYGFGTGAG---TLSMDNGSQFLRENGDVPSVRNGARLE----PRAIAR--APEGEG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 17/59 (29%)
BAR <147..>265 CDD:299863
TGc 418..486 CDD:214673
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 17/58 (29%)
LIM_CRP_like 120..173 CDD:188712 36/124 (29%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.