powered by:
Protein Alignment Hil and CRIP3
DIOPT Version :9
Sequence 1: | NP_611493.2 |
Gene: | Hil / 37328 |
FlyBaseID: | FBgn0050147 |
Length: | 818 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_996805.2 |
Gene: | CRIP3 / 401262 |
HGNCID: | 17751 |
Length: | 204 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 22/66 - (33%) |
Similarity: | 27/66 - (40%) |
Gaps: | 9/66 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 STCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS 73
|.|..|.|.||..::|..|. ..:|..|.:|..|...||. ..|.:.|...|| |||..
Human 122 SLCPGCGEPVYFAEKVMSLG--RNWHRPCLRCQRCHKTLTA-----GSHAEHDGVPYC--HVPCY 177
Fly 74 G 74
|
Human 178 G 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.