DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and csrp2

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_957191.1 Gene:csrp2 / 393871 ZFINID:ZDB-GENE-040426-1863 Length:193 Species:Danio rerio


Alignment Length:66 Identity:20/66 - (30%)
Similarity:31/66 - (46%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS-G 74
            |.||.:.||..:::  :.....:|..||:|..||..|...|     ..:.|.|:||.:...|: |
Zfish   119 CARCGDAVYAAEKI--MSAGKPWHKNCFRCAKCGKSLESTT-----QTEKDGEIYCKACYAKNFG 176

  Fly    75 P 75
            |
Zfish   177 P 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 17/58 (29%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
csrp2NP_957191.1 LIM1_CRP2 9..63 CDD:188864
LIM2_CRP2 119..172 CDD:188871 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.