DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and csrp1a

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_991130.1 Gene:csrp1a / 378726 ZFINID:ZDB-GENE-030909-4 Length:192 Species:Danio rerio


Alignment Length:81 Identity:25/81 - (30%)
Similarity:34/81 - (41%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS-- 73
            |.|||:.||..::|  :.....:|.|||:|..||..|...|..:.     |.|:||.....|:  
Zfish   118 CPRCSKAVYAAEKV--IGAGNAWHRGCFRCAMCGKGLESTTLADK-----DGEIYCKGCYAKNFG 175

  Fly    74 --------GPGHLDQT 81
                    |.|.|..|
Zfish   176 PKGFGYGQGAGALSHT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 20/58 (34%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
csrp1aNP_991130.1 LIM1_CRP1 7..62 CDD:188863
LIM2_CRP 118..171 CDD:188787 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.