DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Mical2

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_038941120.1 Gene:Mical2 / 365352 RGDID:1311773 Length:1103 Species:Rattus norvegicus


Alignment Length:144 Identity:36/144 - (25%)
Similarity:55/144 - (38%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKSG 74
            ||..|.:.||.::|:.  .:..|||..||:|..|...|.:..|   ....|:.:.||..|.    
  Rat   980 TCYFCKKRVYVMERLS--AEGHFFHRECFRCSVCAAILRVAAY---AFDCDEGKFYCKLHF---- 1035

  Fly    75 PGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGGPLGGSRQSTP--NGYGSREISSPSQND 137
             .|...:|   :|.......|:...|:  ||..|.:     .:|:..|  :......||:|..:.
  Rat  1036 -AHCKTSS---KQRKRRAELNQQREEE--GTWPEQE-----AARRDVPAESSCAVAAISTPEGSP 1089

  Fly   138 SDYKYGRFDASALH 151
            .    .||....||
  Rat  1090 P----VRFSLPVLH 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 17/58 (29%)
BAR <147..>265 CDD:299863 2/5 (40%)
TGc 418..486 CDD:214673
Mical2XP_038941120.1 FAD_binding_3 87..>274 CDD:396193
CH_MICAL2 514..623 CDD:409099
LIM_Mical 981..1035 CDD:188823 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.