DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and CG33521

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster


Alignment Length:441 Identity:95/441 - (21%)
Similarity:164/441 - (37%) Gaps:129/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRPNFYE--STCLRCSETVYQVDRV-GPLKD-FTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDD 61
            ::|....|  ..|.:|.:.||:::.| ..||. .|.||..|.:|..||..|...:|  |.|   |
  Fly    68 LFRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSY--NVH---D 127

  Fly    62 KEVYCSSH-----VPK-----------------SGPGHL--------DQTSVGIRQALNAPRTNK 96
            ..:|||.|     .||                 :.|..|        |:.|:|:.:.......:|
  Fly   128 GSLYCSMHFKLIFAPKVVYEEFTPRKAELIIRENQPIKLPPDVAKASDKPSLGLDELQELNLRSK 192

  Fly    97 FV---------NEQIRG------TRSEVDGGPLGGSRQST---------PNGYGSREISSPSQND 137
            |.         |..:|.      |.|:        |.|||         ||...::.....|.|:
  Fly   193 FKVFENGYEEHNNNLRERQDIAITHSK--------SIQSTLTKFHGLGIPNSELTKLDDKNSDNN 249

  Fly   138 SDYKYGRFDASALHIAHALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFAS 202
            ||   |..|.:.:    .||: ||:      ||.|:..     .:|..:::.:.|:.||      
  Fly   250 SD---GDGDMNFM----CLKK-EIE------RETPVGL-----GEAMNDIRSKFEQGDL------ 289

  Fly   203 KRAEEDRKIQDEFQDEWERELQRLTHKFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRS 267
             .|:|.|:      :|.::|:|.:..:.  .|....:.::...:.....||....:.|...:...
  Fly   290 -MAKEGRR------EERKQEIQNIRSRL--FLGKQAKIKEMYKLAVAESEQPVTSVGKTPDICAI 345

  Fly   268 KKKESITRKMLEHERYETAALVD-------RQSSEMLE--LISARRSEYMQSESIFLDDEFSEG- 322
            |..:.|..:....|.|:.:.::.       .:.:::.|  :..|.|:.:|:     ||.....| 
  Fly   346 KPTQEIKNRFENGEVYKDSKILSSEVSCGIHEDADVFESGISKASRNIFMK-----LDANIKSGL 405

  Fly   323 AVPVEYPLNAPIPAPPAVSKFQIYTDPI-EFEDVDRIAISVAQEDQKTFTD 372
            :..|:|.|      |.  .|:||:...: |..||:.:......|:.|..|:
  Fly   406 SNHVQYTL------PD--KKYQIHNQKVQENSDVEIVKSDSKPEEVKVATE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 23/65 (35%)
BAR <147..>265 CDD:299863 21/117 (18%)
TGc 418..486 CDD:214673
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.