DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Mical1

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_038954550.1 Gene:Mical1 / 294520 RGDID:1309386 Length:1058 Species:Rattus norvegicus


Alignment Length:398 Identity:79/398 - (19%)
Similarity:131/398 - (32%) Gaps:136/398 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPK 72
            |..|..|.:.:|.::|.  ..|..|||.|||.|..|  :.||:.....|: ..|...||..|:|:
  Rat   678 EDVCELCGKRLYILERF--CVDGHFFHRGCFCCRTC--EATLRPGGYGQY-PGDGYFYCLQHLPQ 737

  Fly    73 SGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGGPLGGSRQSTPNGYGSREISSPSQND 137
            ......|.......|.|..|..:         |.......|:....:::|       :.||||..
  Rat   738 EDQKEADNNGSPENQELPTPGDS---------TTQSGPSSPVPPVTEASP-------VPSPSQPA 786

  Fly   138 SDY----KYGRFDASALHI--------------------AHALKQTEIQKAYNKAREKPIDFYLA 178
            ...    ...|...|:|:|                    ..:||.:.:.....:|.:.|......
  Rat   787 RRLIRLSSVERLRLSSLNIIPDSGVEPPPKPPRSCLDLAQESLKSSFMGWGVLRAPQVPEAIEKG 851

  Fly   179 REEQAHLEMKHRKEED-------------DL------------------------YRKFASKRAE 206
            .||:...|.:..:||:             ||                        :|:...:||:
  Rat   852 EEEEEEEEEEEEEEEELPPPLALEVEQGPDLTAPTLPQSLLTLAKNSGDMTKYPTWRRTLMRRAK 916

  Fly   207 EDRKIQDEFQDEWER-----ELQRLTHKFE---KELATSRRSRDEANILTMRHEQQKEDLEKNMT 263
            |         :|.:|     .:||..::.|   :||.|.....:.|    :|.|....:.:|.:.
  Rat   917 E---------EEMKRFCKAQAIQRRLNEIEAAMRELETEGMKLEVA----LRKESSSPEKQKKLW 968

  Fly   264 LRR-----SKKKESIT-----------------RKMLEHE-----RYET-AALVDRQSSE----- 295
            |.:     .||...:|                 ::.|:||     |.|| ....||.|.:     
  Rat   969 LEQLLQLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHEFRGINREETLKTQADRLSEDRVLRK 1033

  Fly   296 MLELISAR 303
            :|::::.|
  Rat  1034 LLDVVNQR 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 19/58 (33%)
BAR <147..>265 CDD:299863 30/182 (16%)
TGc 418..486 CDD:214673
Mical1XP_038954550.1 FAD_binding_3 85..>122 CDD:396193
CH_MICAL1 506..611 CDD:409045
LIM 681..734 CDD:413332 19/57 (33%)
DUF3585 929..1056 CDD:403377 25/117 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.