DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Csrp1

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_058844.1 Gene:Csrp1 / 29276 RGDID:62053 Length:193 Species:Rattus norvegicus


Alignment Length:67 Identity:24/67 - (35%)
Similarity:32/67 - (47%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRV-GPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS- 73
            |.|||:.||..::| |..|.   :|..||:|..||..|...|..:.     |.|:||.....|: 
  Rat   119 CPRCSQAVYAAEKVIGAGKS---WHKSCFRCAKCGKGLESTTLADK-----DGEIYCKGCYAKNF 175

  Fly    74 GP 75
            ||
  Rat   176 GP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 21/59 (36%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
Csrp1NP_058844.1 LIM1_CRP1 8..63 CDD:188863
Nuclear localization signal. /evidence=ECO:0000255 64..69
LIM2_CRP 119..172 CDD:188787 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.