DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and ZK622.4

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_494993.2 Gene:ZK622.4 / 191367 WormBaseID:WBGene00022782 Length:100 Species:Caenorhabditis elegans


Alignment Length:65 Identity:37/65 - (56%)
Similarity:45/65 - (69%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKSGP 75
            |.||....|..|::|||||.:.||.|||||..|||:|:||||.||::...|.||||:.|||..||
 Worm     5 CFRCKRPTYFNDKMGPLKDGSMFHKGCFKCWICGTRLSLKTYHNNRNDNTDLEVYCAGHVPTPGP 69

  Fly    76  75
             Worm    70  69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 32/58 (55%)
BAR <147..>265 CDD:299863
TGc 418..486 CDD:214673
ZK622.4NP_494993.2 LIM_Ltd-1 5..64 CDD:188827 32/58 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398889at33208
OrthoFinder 1 1.000 - - FOG0003908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.