powered by:
Protein Alignment Hil and ZK622.4
DIOPT Version :9
Sequence 1: | NP_611493.2 |
Gene: | Hil / 37328 |
FlyBaseID: | FBgn0050147 |
Length: | 818 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494993.2 |
Gene: | ZK622.4 / 191367 |
WormBaseID: | WBGene00022782 |
Length: | 100 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 37/65 - (56%) |
Similarity: | 45/65 - (69%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKSGP 75
|.||....|..|::|||||.:.||.|||||..|||:|:||||.||::...|.||||:.|||..||
Worm 5 CFRCKRPTYFNDKMGPLKDGSMFHKGCFKCWICGTRLSLKTYHNNRNDNTDLEVYCAGHVPTPGP 69
Fly 76 75
Worm 70 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D398889at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003908 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.