DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and valv-1

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_501187.1 Gene:valv-1 / 182010 WormBaseID:WBGene00015216 Length:84 Species:Caenorhabditis elegans


Alignment Length:82 Identity:27/82 - (32%)
Similarity:35/82 - (42%) Gaps:22/82 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PNFYESTCLRCSETVYQVDRVGPL-KDFTFFHSGCFKCVH--CGTKLTLKTYFNNQHKQDDKEVY 65
            ||     |..|.:.||..:||..| ||   :|..|.||.:  ||     ||.....|.:.:.:.|
 Worm     2 PN-----CPNCQKPVYFAERVSSLGKD---WHRPCLKCANKACG-----KTLSAGSHSEHEGKPY 53

  Fly    66 CSS-----HVPKSGPGH 77
            |:.     ..|| |.||
 Worm    54 CNRCYGALFGPK-GYGH 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 20/66 (30%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
valv-1NP_501187.1 LIM_TLP_like 4..58 CDD:188785 20/61 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.