DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Neb

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_006497839.1 Gene:Neb / 17996 MGIID:97292 Length:7523 Species:Mus musculus


Alignment Length:455 Identity:82/455 - (18%)
Similarity:158/455 - (34%) Gaps:136/455 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RGTRSEVDGGPLGGSRQSTPNGYGSREISSPSQNDSDYKYGRFDASALHIAHALKQTEIQKAYNK 167
            :|.....|..|:..::       .||.|:      |||||                   ::||.|
Mouse  1301 KGNNVLADAIPITAAK-------SSRNIA------SDYKY-------------------KEAYEK 1333

  Fly   168 AREKPIDFYLAREEQAHLEMKHRKEEDD--LYRKFASKRAEEDRKIQDEFQDEWERELQRLTHKF 230
            |:.|.:.|              |..:||  |.......:.:.||:.:..:::             
Mouse  1334 AKGKHVGF--------------RSLQDDPKLVHYMNVAKLQSDREYKKNYEN------------- 1371

  Fly   231 EKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESITRKMLEHERYETAALVDRQSSE 295
                 |........:::::...:..:|:..|:..::.          |.|..|         ..:
Mouse  1372 -----TKTSYHTPGDMVSITAARMAQDVATNVNYKQP----------LHHYTY---------LPD 1412

  Fly   296 MLELISARRSEYMQSESIFLDDEFSE-----GAVPV-EYPLNAPIPAPPAVS--KFQIYTDPIEF 352
            .|.|...|.:..:||:::: .||::.     |.:|: ...:.....|..|::  |::.:.|.|:|
Mouse  1413 ALSLEHTRNANQIQSDNVY-KDEYNSFFKGIGWIPIGSLEVEKAKKAGEALNERKYRQHPDTIKF 1476

  Fly   353 EDV-DRIAISVAQEDQKTFTDLVRQLVG-----RCTTDIEKARTIFRWITVKNLNAMHFDDDLRG 411
            ..| |.:.:.:||::.|..:||..::.|     :.|.|.|..:.|...:...|::..|:    :.
Mouse  1477 TSVPDSMGMVLAQQNTKQLSDLNYKVEGEKMKHKYTMDPELPQFIQAKVNAINMSDAHY----KA 1537

  Fly   412 DTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPG----------------VK 460
            |....|.:|.....::..::..:........|...:.|.|:.|.|.|                .|
Mouse  1538 DWKKTLAKGYDLRPDAIPIVAAKSSRNIASDCKYKEAYEKARGKQIGFLSLQDDPKLVHYMNVAK 1602

  Fly   461 FQDSRFRNSWNAVYVAGAWRFVQCNWGARH----LVNAKEAPK-QGRGKNDSLRYEYDDHYFLTD 520
            .|..|   .:...|.|...|:        |    :.:...|.| |....|.:.|..|.::..|.|
Mouse  1603 IQSDR---EYKKGYEASKTRY--------HTPLDMFSVTAAKKSQEVATNSNYRQPYHNYTLLPD 1656

  Fly   521  520
            Mouse  1657  1656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827
BAR <147..>265 CDD:299863 15/119 (13%)
TGc 418..486 CDD:214673 13/83 (16%)
NebXP_006497839.1 Nebulin 79..105 CDD:366355
Nebulin 151..175 CDD:366355
NEBU 178..207 CDD:128523
NEBU 248..278 CDD:128523
NEBU 532..562 CDD:128523
Nebulin 575..601 CDD:366355
Nebulin 613..639 CDD:366355
Nebulin 786..812 CDD:366355
Nebulin 822..848 CDD:366355
Nebulin 860..886 CDD:366355
NEBU 888..918 CDD:128523
NEBU 919..948 CDD:128523
Nebulin 1104..1130 CDD:366355
NEBU 1163..1192 CDD:128523
NEBU 1232..1262 CDD:128523
NEBU 1267..1297 CDD:128523
Nebulin 1310..1336 CDD:366355 13/57 (23%)
Nebulin 1348..1374 CDD:366355 4/43 (9%)
NEBU 1476..1506 CDD:128523 9/29 (31%)
NEBU 1511..1541 CDD:128523 7/33 (21%)
NEBU 1756..1785 CDD:128523
Nebulin 1836..1862 CDD:366355
NEBU 1895..1923 CDD:128523
NEBU 1964..1993 CDD:128523
NEBU 2000..2029 CDD:128523
Nebulin 2042..2068 CDD:366355
Nebulin 2080..2106 CDD:366355
NEBU 2244..2273 CDD:128523
Nebulin 2324..2350 CDD:366355
NEBU 2451..2481 CDD:128523
Nebulin 2567..2593 CDD:366355
NEBU 2730..2759 CDD:128523
Nebulin 2810..2836 CDD:366355
Nebulin 3053..3079 CDD:366355
NEBU 3180..3210 CDD:128523
Nebulin 3296..3322 CDD:366355
NEBU 3423..3453 CDD:128523
NEBU 3567..3597 CDD:128523
Nebulin 3606..3631 CDD:366355
Nebulin 3782..3808 CDD:366355
NEBU 3909..3938 CDD:128523
NEBU 3945..3974 CDD:128523
Nebulin 3992..4013 CDD:366355
NEBU 4152..4182 CDD:128523
NEBU 4188..4217 CDD:128523
Nebulin 4230..4256 CDD:366355
Nebulin 4268..4294 CDD:366355
Nebulin 4335..4360 CDD:366355
NEBU 4395..4425 CDD:128523
Nebulin 4475..4499 CDD:366355
NEBU 4638..4668 CDD:128523
NEBU 4674..4703 CDD:128523
Nebulin 4715..4741 CDD:366355
Nebulin 5131..5157 CDD:366355
Nebulin 5973..5999 CDD:366355
NEBU 6211..6241 CDD:128523
Nebulin 6537..6563 CDD:366355
Nebulin 6645..6670 CDD:366355
NEBU 6747..6775 CDD:128523
NEBU 6819..6849 CDD:128523
NEBU 6890..6916 CDD:128523
NEBU 7045..7074 CDD:128523
NEBU 7138..7163 CDD:128523
Nebulin 7273..7299 CDD:366355
SH3_Nebulin_C 7466..7523 CDD:212866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.