DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and CSRP2

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001400468.1 Gene:CSRP2 / 1466 HGNCID:2470 Length:243 Species:Homo sapiens


Alignment Length:67 Identity:21/67 - (31%)
Similarity:32/67 - (47%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDR-VGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS- 73
            |.||.::||..:: :|..|.   :|..||:|..||..|...|.     .:.:.|:||.....|: 
Human   169 CSRCGDSVYAAEKIIGAGKP---WHKNCFRCAKCGKSLESTTL-----TEKEGEIYCKGCYAKNF 225

  Fly    74 GP 75
            ||
Human   226 GP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 18/59 (31%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
CSRP2NP_001400468.1 LIM1_CRP2 9..63 CDD:188864
LIM2_CRP2 169..222 CDD:188871 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.