powered by:
Protein Alignment Hil and CSRP1
DIOPT Version :9
Sequence 1: | NP_611493.2 |
Gene: | Hil / 37328 |
FlyBaseID: | FBgn0050147 |
Length: | 818 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001180500.1 |
Gene: | CSRP1 / 1465 |
HGNCID: | 2469 |
Length: | 193 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 32/67 - (47%) |
Gaps: | 10/67 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 CLRCSETVYQVDRV-GPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS- 73
|.|||:.||..::| |..|. :|..||:|..||..|...|..:. |.|:||.....|:
Human 119 CPRCSQAVYAAEKVIGAGKS---WHKACFRCAKCGKGLESTTLADK-----DGEIYCKGCYAKNF 175
Fly 74 GP 75
||
Human 176 GP 177
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.