DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and CSRP1

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001180500.1 Gene:CSRP1 / 1465 HGNCID:2469 Length:193 Species:Homo sapiens


Alignment Length:67 Identity:24/67 - (35%)
Similarity:32/67 - (47%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRV-GPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKS- 73
            |.|||:.||..::| |..|.   :|..||:|..||..|...|..:.     |.|:||.....|: 
Human   119 CPRCSQAVYAAEKVIGAGKS---WHKACFRCAKCGKGLESTTLADK-----DGEIYCKGCYAKNF 175

  Fly    74 GP 75
            ||
Human   176 GP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 21/59 (36%)
BAR <147..>265 CDD:299863
TGc 418..486 CDD:214673
CSRP1NP_001180500.1 LIM1_CRP1 8..63 CDD:188863
Nuclear localization signal. /evidence=ECO:0000255 64..69
LIM2_CRP 119..172 CDD:188787 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.