Protein Alignment Hil and Csrp3

DIOPT Version :9

• Sequence 1: NP_611493.2
• Gene: Hil / 37328
• FlyBaseID: FBgn0050147
• Length: 818
• Species: Drosophila melanogaster
• Sequence 2: NP_476485.2
• Gene: Csrp3 / 117505
• RGDID: 71092
• Length: 194
• Species: Rattus norvegicus
• Alignment Length: 86
• Identity: 27/86 - (31%)
• Similarity: 39/86 - (45%)
• Gaps: 16/86 - (18%)

  Fly     2 YRPNFYES-TCLRCSETVYQVDRV-GPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEV 64
            :...|.|| .|.||.::||..::| |..|.   :|..||:|..||     |:..:......|.|:
  Rat   110 FSAKFGESEKCPRCGKSVYAAEKVMGGGKP---WHKTCFRCAICG-----KSLESTNVTDKDGEL 166

  Fly    65 YCSSHVPKS-GPGHLDQTSVG 84
            ||.....|: ||     |.:|
  Rat   167 YCKVCYAKNFGP-----TGIG 182

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Hil	NP_611493.2	LIM_Ltd-1	11..70	CDD:188827	19/59 (32%)
		BAR	<147..>265	CDD:299863
		TGc	418..486	CDD:214673
Csrp3	NP_476485.2	Interaction with TCAP. /evidence=ECO:0000250|UniProtKB:P50461	1..5
		LIM1_CRP3	9..62	CDD:188865
		Nuclear localization signal. /evidence=ECO:0000255, ECO:0000305|PubMed:19376126	64..69
		Interaction with CLF2. /evidence=ECO:0000250|UniProtKB:P50461	94..105
		LIM2_CRP3	120..173	CDD:188866	19/60 (32%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810