DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nnf1a and Nnf1b

DIOPT Version :9

Sequence 1:NP_611492.1 Gene:Nnf1a / 37325 FlyBaseID:FBgn0034523 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_722652.1 Gene:Nnf1b / 318874 FlyBaseID:FBgn0051658 Length:204 Species:Drosophila melanogaster


Alignment Length:192 Identity:110/192 - (57%)
Similarity:149/192 - (77%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDSEAAFKRHEGVGPKVKQAYEEAIKQIFADLSCADLQAWDAIYQEHEQSALDTESIVDRTRSLM 66
            ||:||||||.:.|.|:|||||||||.|||:||:.:||::..:|.:|||.::||||.|:..||.||
  Fly     6 EDTEAAFKRLQAVIPQVKQAYEEAIGQIFSDLNSSDLESCASILEEHESTSLDTEQIIHSTRRLM 70

  Fly    67 TKVVLEMNRCFFASNDVPNKLQTLEMLKEHFAAYEGKKWNVNTAAPDKLTRPLRMRFLDFSVEFM 131
            ||:||::|:|||:.|||..||.|||||||.|||:|||.||.|..:|::|||||||..|:.|:.||
  Fly    71 TKIVLDVNQCFFSGNDVETKLTTLEMLKEQFAAHEGKNWNFNCLSPEELTRPLRMHNLNLSITFM 135

  Fly   132 EQQLASQAKELEIAMAKSNANRERLQHVHDKRLKLTVQMEQQLSQYEKVKTELIKLGEALND 193
            ||||..|.||||||||||..||:.:..||.:|:|:...|:|||::|:.:|.:|:::...:||
  Fly   136 EQQLKKQEKELEIAMAKSIKNRQLIHDVHAERVKVGCMMKQQLAEYQAIKPQLMEMERLIND 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nnf1aNP_611492.1 46 <124..>194 CDD:222878 34/70 (49%)
Nnf1bNP_722652.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447161
Domainoid 1 1.000 45 1.000 Domainoid score I19331
eggNOG 1 0.900 - - E1_2CEBN
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I7683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019645
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.