DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgat1 and pomgnt1

DIOPT Version :9

Sequence 1:NP_525117.2 Gene:Mgat1 / 37323 FlyBaseID:FBgn0034521 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001036152.3 Gene:pomgnt1 / 571876 ZFINID:ZDB-GENE-070112-991 Length:653 Species:Danio rerio


Alignment Length:286 Identity:96/286 - (33%)
Similarity:143/286 - (50%) Gaps:56/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CNRV----SVKKCIDNL-VQYRP------SVEQFPIIVSQDCGDEPT------KEAILSYGKQVT 174
            |::|    |:..|.|.. :::.|      :|...|:.|.  .|:.|.      :..:.|:|....
Zfish   264 CSKVEGYGSICSCKDPAPIEFNPDPLSNNNVYNIPVAVI--AGNRPNYLYRMLRSLLSSHGVNPQ 326

  Fly   175 LI--------EQP-DLSDITVLPKEKKFKGYY---------KIARHYGWALNTTFAV--GFEFVI 219
            :|        |:| |:.|:..|      ||..         ::::||..:|..||.:  ..:|.|
Zfish   327 MITVFIDGYYEEPMDVVDLFGL------KGVQHTPISIKNARVSQHYKASLTATFNLHPDADFAI 385

  Fly   220 IVEDDLNVAPDFFEYFLGTHKLLKQDPSLWCVSAWNDNGKAAVVDAAQPELLYRTDFFPGLGWML 284
            ::|:||:::.|||.:...|..||.:|.||:|:|||||.|....  |..|.||||.:..|||||:|
Zfish   386 VLEEDLDISIDFFSFLGQTIHLLHEDDSLYCISAWNDQGYEHT--AEDPSLLYRVESMPGLGWVL 448

  Fly   285 TKDLWA-ELSVKWPKS----FWDDWIRHPAQRKDRVCIRPEISRTRTFGKIGVS-NGLFFDKYLK 343
            .|.|:. ||..|||..    .||.|:|.|.|||.|.|:.|::||:..||.||:: ||.|.:.|.|
Zfish   449 KKSLYKDELEPKWPTPEKLWDWDMWMRMPEQRKGRECVIPDVSRSYHFGIIGLNMNGYFHEVYFK 513

  Fly   344 HIKLSE-DFVQFTKINMSYLLKDNYD 368
            ..|.:. ..||..  |:..|.||.|:
Zfish   514 KHKFNTIPNVQMK--NVENLKKDPYE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mgat1NP_525117.2 GT13_GLCNAC-TI 119..449 CDD:133007 96/286 (34%)
pomgnt1NP_001036152.3 PANDER_GnT-1_2_like 94..241 CDD:260111
GT13_GLCNAC-TI 296..623 CDD:133007 89/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324622at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.