DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgat1 and F48E3.9

DIOPT Version :9

Sequence 1:NP_525117.2 Gene:Mgat1 / 37323 FlyBaseID:FBgn0034521 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_509264.3 Gene:F48E3.9 / 185982 WormBaseID:WBGene00018608 Length:611 Species:Caenorhabditis elegans


Alignment Length:103 Identity:23/103 - (22%)
Similarity:35/103 - (33%) Gaps:42/103 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 TKINMSYLLKDNYDNTFLRRVYTYPIVTYDELRRNLIRIEG-----------PVRIQYTTREQYK 408
            ::||.|            ||..|..|:.    |.|.:.|.|           |:....:.|.||.
 Worm   119 SQINQS------------RRGTTTQILA----RGNEVSINGETWCQLPPHHPPIPAIISDRSQYS 167

  Fly   409 RTTKMLGLMDDFKSGVPRTAYHGIVSFYYNKRRVHLAP 446
            :           :.|..|:||    .:|:..||.:..|
 Worm   168 Q-----------RIGRDRSAY----DYYHRDRREYSVP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mgat1NP_525117.2 GT13_GLCNAC-TI 119..449 CDD:133007 23/103 (22%)
F48E3.9NP_509264.3 Smc <281..567 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1413
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.