DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgat1 and gly-12

DIOPT Version :9

Sequence 1:NP_525117.2 Gene:Mgat1 / 37323 FlyBaseID:FBgn0034521 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_741838.1 Gene:gly-12 / 181005 WormBaseID:WBGene00001637 Length:467 Species:Caenorhabditis elegans


Alignment Length:378 Identity:135/378 - (35%)
Similarity:193/378 - (51%) Gaps:72/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VFPVVVFACNRV-SVKKCIDNLVQYRPSVEQFPIIVSQDCGDEPTKEAILSYGKQVTLIEQ---P 179
            |..|:||...|. :::..:..::..|||..|:.|||||| |::..          ||.:.|   .
 Worm    71 VAAVLVFCATRPDALRNHLSQILAQRPSHFQYHIIVSQD-GNKTA----------VTQVAQKFVK 124

  Fly   180 DLSDITVLPKE----KKFKGYYKIARHYGWALNTTFAVGFEF--VIIVEDDLNVAPDFFEYFLGT 238
            |..:::.:..|    ||...|..|:.||.|||:..|. ||.:  ||:.||||::..|||.||...
 Worm   125 DYKNVSHIQHEKTEIKKRNNYPAISAHYKWALDKAFK-GFRYDHVIVTEDDLDIGNDFFSYFRWG 188

  Fly   239 HKLLKQDPSLWCVSAWNDNGKAAVVDAAQPELLYRTDFFPGLGWMLTKDLWAELSVKWPKSFWDD 303
            .::|..|.::||||||||||...::|:.:.:|::||||||||||||||.||.|||..:|.::|||
 Worm   189 KQVLNSDDTIWCVSAWNDNGGGPLIDSTRGDLIWRTDFFPGLGWMLTKKLWNELSPGFPVAYWDD 253

  Fly   304 WIRHPAQRKDRVCIRPEISRT----RTFGKIGVSNGLFFDKYLKHIKLSEDFVQFTKINMSYLLK 364
            |:|.|..||.|.|||||||||    :..|| |.|.|:|.| ||..|..|...:.|:.:.::.:.|
 Worm   254 WMRKPEVRKSRSCIRPEISRTSHNMKLAGK-GSSGGMFKD-YLSKISASSANIDFSLLPVTLVQK 316

  Fly   365 DNYD-----------------NTFLRRVYTYPIVTYDELRRNLIRIEGPVRIQYTTREQYKRTTK 412
            ..||                 .|.:.:.|.|.|| |..:|                  .:.|...
 Worm   317 SIYDKRLIEQIENARPIDLQNTTGMEKTYNYKIV-YKNIR------------------DWHRLAA 362

  Fly   413 MLGLMDDFKSGVPRTAYHGIVSFYYNKRRVHLAPNANWKG--------YELSW 457
            ...||.|.:.|:.||||:|:|:..:...||.|.|.:.::.        |:..|
 Worm   363 HFKLMTDIRGGMQRTAYYGVVTLMFQNCRVFLVPESTYRNPSQLTSYVYDSEW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mgat1NP_525117.2 GT13_GLCNAC-TI 119..449 CDD:133007 133/360 (37%)
gly-12NP_741838.1 GT13_GLCNAC-TI 71..399 CDD:133007 133/360 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55205
OrthoDB 1 1.010 - - D1324622at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104509
Panther 1 1.100 - - O PTHR10468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.