DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and HB-3

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:202 Identity:57/202 - (28%)
Similarity:82/202 - (40%) Gaps:66/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSQSAVR---RYP-HSFSIEQILAKPEMRSSTSFEDSVQDES--------------GRGGNCL-- 46
            |:|..:|   .:| |.|..:|:           .||:.....              |.|||.:  
plant    13 NNQEGLRLEMAFPQHGFMFQQL-----------HEDNAHHLPSPTSLPSCPPHLFYGGGGNYMMN 66

  Fly    47 ------GAS-----RASSPATSSCLDDNMDDGKSDIDLASDDGNG--LGDDRKKRPRTAFSAAQI 98
                  |.|     ...||.|::.::|  .|...:.|..||||:.  ||:.:|:     .:..|:
plant    67 RSMSFTGVSDHHHLTQKSPTTTNNMND--QDQVGEEDNLSDDGSHMMLGEKKKR-----LNLEQV 124

  Fly    99 KALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRK---------------YTSD 148
            :|||..||.|..|...::..|||.|.|...||.|||||||.:||.|               ..||
plant   125 RALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSD 189

  Fly   149 VETLASH 155
            .::|.:|
plant   190 NDSLLAH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 24/101 (24%)
Homeobox 89..142 CDD:278475 22/52 (42%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 23/57 (40%)
HALZ 170..208 CDD:280364 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.