powered by:
Protein Alignment lms and HB40
DIOPT Version :9
Sequence 1: | NP_001286635.1 |
Gene: | lms / 37322 |
FlyBaseID: | FBgn0034520 |
Length: | 378 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001329011.1 |
Gene: | HB40 / 829827 |
AraportID: | AT4G36740 |
Length: | 217 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 26/71 - (36%) |
Similarity: | 36/71 - (50%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 ASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRR 138
::|.||||...|| .:..|:..||..|.....|...::..||.:|.|...|:.:||||||
plant 47 SADGGNGLFRKRK------LTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRR 105
Fly 139 TKWKRK 144
.:||.|
plant 106 ARWKNK 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lms | NP_001286635.1 |
Cnd2 |
33..>106 |
CDD:303063 |
10/31 (32%) |
Homeobox |
89..142 |
CDD:278475 |
16/52 (31%) |
HB40 | NP_001329011.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.