DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and hmx1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001106998.1 Gene:hmx1 / 797503 ZFINID:ZDB-GENE-080204-54 Length:282 Species:Danio rerio


Alignment Length:242 Identity:71/242 - (29%)
Similarity:113/242 - (46%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAVRRYPHSFSIEQILAKPEMRSSTSFEDSVQD-------------ESGRGGNCLGASRASSPAT 56
            :|::|||:::..|..:    ..||..|:..:..             |..|..:....|...:|..
Zfish    47 NALKRYPNAYRKEMCV----QASSAGFKTEISPLEWKGRETSRSPREESRNSSEYSRSDRDTPLA 107

  Fly    57 SSCLD------------DNMDDGKSDIDLAS-DDGNGLGDDRKKRPRTAFSAAQIKALETEFERG 108
            |..||            |..||.:...|..| .|.:..|..|||:.||.||.:|:..||:.|:..
Zfish   108 SEPLDGVVDRKMSGCAVDEGDDARQLFDERSGPDTSEPGSARKKKTRTVFSRSQVFQLESTFDMK 172

  Fly   109 KYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGGLAR-PMVVG 172
            :|||.::|..||..|.|||||:||||||||.||||:..:|:|.:..::.:|    .:.| |::..
Zfish   173 RYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAADLEAVNFNHNSQ----RIVRVPILYH 233

  Fly   173 DRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRPYATS 219
            |:          .||:.::..|.|..:.|:...:.:...|:..:|.|
Zfish   234 DK----------ATPMSTLSFNVSQVSPPLMGFSNSVNYPLSSFAHS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 24/98 (24%)
Homeobox 89..142 CDD:278475 29/52 (56%)
hmx1NP_001106998.1 Homeobox 153..206 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5048
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.