| Sequence 1: | NP_001286635.1 | Gene: | lms / 37322 | FlyBaseID: | FBgn0034520 | Length: | 378 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_072159.1 | Gene: | Vax2 / 64572 | RGDID: | 621133 | Length: | 292 | Species: | Rattus norvegicus |
| Alignment Length: | 238 | Identity: | 74/238 - (31%) |
|---|---|---|---|
| Similarity: | 103/238 - (43%) | Gaps: | 54/238 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 QDESGRGGNCLGASR---------------------ASSPATSSCLDDNMDD----GKSD----I 71
Fly 72 DLASDDG--------NGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTET 128
Fly 129 QIKIWFQNRRTKWKRKYTSDVETLA-SHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIM 192
Fly 193 LNGSGSAAPMAS-ATTATGSP------MRPYATSGGMPPLPGP 228 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| lms | NP_001286635.1 | Cnd2 | 33..>106 | CDD:303063 | 31/106 (29%) |
| Homeobox | 89..142 | CDD:278475 | 30/52 (58%) | ||
| Vax2 | NP_072159.1 | vax upstream domain | 74..101 | 5/26 (19%) | |
| homeobox | 102..161 | 33/58 (57%) | |||
| Homeobox | 105..158 | CDD:278475 | 30/52 (58%) | ||
| vax downstream domain | 182..193 | 3/14 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..241 | 5/28 (18%) | |||
| vax terminal domain | 266..274 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||