DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Vax1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_072158.1 Gene:Vax1 / 64571 RGDID:621132 Length:336 Species:Rattus norvegicus


Alignment Length:293 Identity:86/293 - (29%)
Similarity:119/293 - (40%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGRGGNCLGASRASSPATSSCLDDNMDDGKSDI-DLASDDGNGLGDDRKKRPRTAFSAAQIKALE 102
            ||...:|..:...||.....|....:.|.|..| ::...  .||..||.||.||:|:|.|:..||
  Rat    54 SGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILP--KGLDLDRPKRTRTSFTAEQLYRLE 116

  Fly   103 TEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSD-------VETLASHYYAQL 160
            .||:|.:|:...:||.||:||.|:|||:|:||||||||.|:....|       .||.|:....:|
  Rat   117 MEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRL 181

  Fly   161 ----------GIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRP 215
                      |:..|..|...|    .......||    |:...|:|:||..|:|..|..:...|
  Rat   182 LEQGRLLSPPGLPALLPPCATG----ALGSALRGP----SLPALGAGAAAGSAAAAAAAATAPGP 238

  Fly   216 YATSGGMPP----LPGPSVMESARNAILARGQPLNFALPFGVAKPPAG---GVPAASY------I 267
            ...:...||    .|||.                    |.|    |.|   |.|.||:      :
  Rat   239 AGAASQHPPAVGGAPGPG--------------------PAG----PGGLHAGAPTASHGLFSLPV 279

  Fly   268 PR-----CKPYATSYVDYAASLPTNESYLQMKY 295
            |.     ....:::.:..|.||..|...|..:|
  Rat   280 PSLLGSVASRLSSAPLTMAGSLAGNLQELSARY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 23/67 (34%)
Homeobox 89..142 CDD:278475 30/52 (58%)
Vax1NP_072158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..69 4/14 (29%)
vax upstream domain 72..99 6/28 (21%)
homeobox 100..159 33/58 (57%)
Homeobox 103..156 CDD:278475 30/52 (58%)
vax downstream domain 178..189 1/10 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..267 10/54 (19%)
vax terminal domain 315..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.