DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and barhl1a

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:236 Identity:78/236 - (33%)
Similarity:104/236 - (44%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRYPHSFSIEQILA--KP----EMRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDD 66
            |....||.|..|||  ||    ...|||.  .|.||..    :|:....::|.:.|..  ...|:
Zfish    80 RTVTSSFLIRDILADCKPLAACAPYSSTG--QSAQDAE----DCMDKLHSNSSSDSEY--RVKDE 136

  Fly    67 GKSDIDLASDDGNGLGDDRKKRP---RTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTET 128
            ...:|..:.|..|    .|.|:|   ||||:..|:..||..|||.|||||..|..||..|.||:|
Zfish   137 ADREISSSRDSPN----SRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDT 197

  Fly   129 QIKIWFQNRRTKWKRKYTSDVETLAS--------------HYYAQLGIGGLARPMVVGDRLWLFS 179
            |:|.|:|||||||||:....:|.||.              ::|.|    .|...:..|..|:|:.
Zfish   198 QVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYPQ----SLVSNLDPGPGLYLYR 258

  Fly   180 QTPTGPTPIQ-----SIMLNG-SGSAAPMASATTATGSPMR 214
            .....|.|:|     .|:|:| .|...|.:.:......|.|
Zfish   259 GPSAPPPPVQRPLVPRILLHGLQGGGDPASLSGVIPRHPPR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 20/75 (27%)
Homeobox 89..142 CDD:278475 32/55 (58%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 18/60 (30%)
Homeobox 159..211 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_116541
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.