DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and E5

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:59 Identity:34/59 - (57%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKR 143
            :.||.|||||..|:..||..||...|:..|:|..||:.|.|||||:|:||||||||.||
  Fly   302 KPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 10/20 (50%)
Homeobox 89..142 CDD:278475 30/52 (58%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466608
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
65.950

Return to query results.
Submit another query.