DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and NK7.1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:405 Identity:108/405 - (26%)
Similarity:159/405 - (39%) Gaps:73/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IEQILAKPEMRSSTSFEDSV-------QDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDL 73
            :...:|.|...|.|...||:       .:.|..|.|.....::::.:|....:|:.|.|.:|.  
  Fly   328 LSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDA-- 390

  Fly    74 ASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRR 138
                      .|||:.||.|:..||..||..||..||||.::||.:||.|.:||||:||||||||
  Fly   391 ----------RRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRR 445

  Fly   139 TKWKRKYTSDVETLASH--YYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAP 201
            ||||::........|.|  ..|:.|..|.|.....|:.....|...|.||         .|:||.
  Fly   446 TKWKKQDNVTNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPT---------VGNAAT 501

  Fly   202 MASATTATGSPMR-------------PYATSGGMPPLPGPSVMESARNAILARG-QPLNFA---- 248
            :|....:..||.|             ...:.|.:|.....:.::...||:|.:. :..|.|    
  Fly   502 IAEIKKSPKSPNRGSNNNNNNTLNNNVNNSEGKVPAKQSTTKIKKQLNALLEKTVKTANQAHRSA 566

  Fly   249 -LPFGVAKPPAGGVPAAS-----YIPRCKPYATSY-VDYAASLPTNESYLQMKYATLPPEAE--- 303
             |.....||.....|..|     ...|...:|... |:.||.|...|. |.:|....|...|   
  Fly   567 ELESSDQKPAVEKRPNNSNENQLLHQRLHQHAIPLTVEPAAPLEQTEK-LDIKREESPQHRELQL 630

  Fly   304 ----SGASNG-LAELERVFGDANANFLQQRSTPVAGTATAYGHDGLNQAQRSRRPTQSESECSDI 363
                :...|| |.|::         |..:.:......|.|..:..:...:|.:..:.|.....|.
  Fly   631 SLQRAAIQNGQLTEMD---------FESKLAASKISIALAMANKQMQPEKRVKTESSSSEGEGDG 686

  Fly   364 DCEHLDEDEEPPAAE 378
            |.|..:|:||..::|
  Fly   687 DGEEEEEEEEVSSSE 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 20/79 (25%)
Homeobox 89..142 CDD:278475 32/52 (62%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.