DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and vax1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_919391.2 Gene:vax1 / 373870 ZFINID:ZDB-GENE-030904-9 Length:317 Species:Danio rerio


Alignment Length:282 Identity:94/282 - (33%)
Similarity:129/282 - (45%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SSTSFEDSVQDESGRGG--NCLGASRASSPATSSCLDDNMDDGKSDI-DLASDDGNGLGDDRKKR 88
            |.|..:|..:..|..|.  || ..|||||.....|....:.|.|..| ::...  .||..||.||
Zfish    33 SKTFLKDQQESFSPSGAVENC-EKSRASSGDPDYCRRILVRDAKGSIREIILP--KGLDLDRPKR 94

  Fly    89 PRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVE--T 151
            .||:|:|.|:..||.||:|.:|:...:||.||:||.|:|||:|:||||||||.|:....|.|  :
Zfish    95 TRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRS 159

  Fly   152 LASHYYAQLGI------GGLARPMVVGDRLWLFSQTPTGPT---PIQSIMLNG---SGSAAPMAS 204
            :.|...|...:      |.|..|..:...|.....:..|..   |...|..||   |.|::...|
Zfish   160 VVSETAATCSVLRLLEQGRLLTPPGLPGLLPHCGSSSLGSALRGPSLGITANGGSSSSSSSSAGS 224

  Fly   205 ATTATGSPMRPYATSG-------GMPP------LPGPSVMESARNAILARGQPLNFALPFGVAKP 256
            :.||.|||..|..||.       |.||      .|.||::.|..:.|        .:.|.|:|..
Zfish   225 SGTAGGSPPLPTVTSSGTVTGLQGSPPAHGLFSFPMPSLLGSVASRI--------SSTPLGMAGS 281

  Fly   257 PAGGVP--AASYIPRC--KPYA 274
            .||.:.  :|.|:...  :||:
Zfish   282 LAGNLQELSARYLSSSAFEPYS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 28/75 (37%)
Homeobox 89..142 CDD:278475 30/52 (58%)
vax1NP_919391.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 12/29 (41%)
Homeobox 95..148 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..248 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.