DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and unpg

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:219 Identity:66/219 - (30%)
Similarity:99/219 - (45%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QDESGRGGNCLGASRASSPATSSCLDDNMDDG---KSDIDLASDD--------GNGLG------- 82
            :|....|.:|...|...||...:...|...:|   .||.:..|||        |.|:|       
  Fly   247 EDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGN 311

  Fly    83 ----DDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKR 143
                :.:.:|.||||::.|:..||.||...||||:.:|:.:|..|:|:|.|:||||||||.||||
  Fly   312 GSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

  Fly   144 KYTSDVETLASHYYAQLGIGG------LARPMVVG-DRLWLFSQTP-------TGPTP-----IQ 189
            ....    |.||   .||..|      :..|:.|. :|..:.||..       :||.|     :.
  Fly   377 VKAG----LTSH---GLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLS 434

  Fly   190 SIMLNGSGSAAPMASATTATGSPM 213
            :..:.|....:...:|::.:|.|:
  Fly   435 AEAIGGFEKFSGSTNASSPSGGPV 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 25/91 (27%)
Homeobox 89..142 CDD:278475 28/52 (54%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
43.920

Return to query results.
Submit another query.