DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and HMX2

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005510.1 Gene:HMX2 / 3167 HGNCID:5018 Length:273 Species:Homo sapiens


Alignment Length:255 Identity:74/255 - (29%)
Similarity:107/255 - (41%) Gaps:74/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFSIEQIL---------------AKPEMRSSTSFEDSVQD----------------ESGRGGN-- 44
            ||:|:.||               |:....|.:|.|:...|                |.|...:  
Human    19 SFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGWKAPACFCPDQHGPKEQGPKHHPP 83

  Fly    45 ----CLGASRAS----------SPATSSCLDDNMDDGKSDIDLASD--------DGNGLGDDR-- 85
                |||..:.|          :|..|....|..::.:..:...|.        ||   |.:|  
Human    84 IPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAGSPSPGSERPRDG---GAERQA 145

  Fly    86 ---KKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTS 147
               ||:.||.||.:|:..||:.|:..:|||.::|..||..|||||||:|.||||||.||||:.::
Human   146 GAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSA 210

  Fly   148 DVETL-ASHYYAQLGIGGLARPMVVGDRLWLFSQTPTG---PTPIQSIMLNGSG-SAAPM 202
            ::|.. .:|..||..:   :.|:|..|...|....|..   |.|   :...||. ||.|:
Human   211 ELEAANMAHASAQTLV---SMPLVFRDSSLLRVPVPRSLAFPAP---LYYPGSNLSALPL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 24/117 (21%)
Homeobox 89..142 CDD:278475 29/52 (56%)
HMX2NP_005510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 26/135 (19%)
Homeobox 152..205 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.