Sequence 1: | NP_001286635.1 | Gene: | lms / 37322 | FlyBaseID: | FBgn0034520 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005510.1 | Gene: | HMX2 / 3167 | HGNCID: | 5018 | Length: | 273 | Species: | Homo sapiens |
Alignment Length: | 255 | Identity: | 74/255 - (29%) |
---|---|---|---|
Similarity: | 107/255 - (41%) | Gaps: | 74/255 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SFSIEQIL---------------AKPEMRSSTSFEDSVQD----------------ESGRGGN-- 44
Fly 45 ----CLGASRAS----------SPATSSCLDDNMDDGKSDIDLASD--------DGNGLGDDR-- 85
Fly 86 ---KKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTS 147
Fly 148 DVETL-ASHYYAQLGIGGLARPMVVGDRLWLFSQTPTG---PTPIQSIMLNGSG-SAAPM 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lms | NP_001286635.1 | Cnd2 | 33..>106 | CDD:303063 | 24/117 (21%) |
Homeobox | 89..142 | CDD:278475 | 29/52 (56%) | ||
HMX2 | NP_005510.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..152 | 26/135 (19%) | |
Homeobox | 152..205 | CDD:306543 | 29/52 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |