DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and HMX1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_061815.2 Gene:HMX1 / 3166 HGNCID:5017 Length:348 Species:Homo sapiens


Alignment Length:291 Identity:82/291 - (28%)
Similarity:112/291 - (38%) Gaps:93/291 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVRRYPHSFSIEQILAKPEMRSSTSFEDSVQ--DESGRG-----------------------GNC 45
            |.|.||.:.........|:    ||..||.:  :|.||.                       |..
Human   113 AARWYPRAHGGYGGGLSPD----TSDRDSPETGEEMGRAEGAWPRGPGPGAVQREAAELAARGPA 173

  Fly    46 LGASRASSPATSSCLDDNMDDGKSDIDLASDD---GNGLGDDRKKRPRTAFSAAQIKALETEFER 107
            .|...||..|              ::..|:.:   |.|:|..|||:.||.||.:|:..||:.|:.
Human   174 AGTEEASELA--------------EVPAAAGETRGGVGVGGGRKKKTRTVFSRSQVFQLESTFDL 224

  Fly   108 GKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGGLARPMVVG 172
            .:|||.|:|..||..|||||||:||||||||.||||:..:::|.      |.|...|..|.:.| 
Human   225 KRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEA------ASLSPPGAQRLVRV- 282

  Fly   173 DRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRPYATSGGMPPLPGPSVMESARNA 237
                             .::.:.|..||..|........|:.|.|      |.|.|.:       
Human   283 -----------------PVLYHESPPAAAAAGPPATLPFPLAPAA------PAPPPPL------- 317

  Fly   238 ILARGQPLNFALPFGVAKPPAGGVPAASYIP 268
                   |.|:   |....|....|||:.:|
Human   318 -------LGFS---GALAYPLAAFPAAASVP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 24/100 (24%)
Homeobox 89..142 CDD:278475 31/52 (60%)
HMX1NP_061815.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..203 21/107 (20%)
Homeobox 206..259 CDD:278475 31/52 (60%)
HMX family specific domain 1 263..273 3/15 (20%)
HMX family specific domain 2 276..289 2/30 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.