DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Hmx3

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001099772.1 Gene:Hmx3 / 293537 RGDID:1559927 Length:356 Species:Rattus norvegicus


Alignment Length:253 Identity:74/253 - (29%)
Similarity:107/253 - (42%) Gaps:73/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFSIEQILAKPEMRSSTSFEDSVQDES--GRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLAS 75
            |.|.::|:    :..|.|.|...:.|:  |..|..:||: |::|            |..|....:
  Rat   169 SKSPDEII----LEESDSEEGKKEGEAVPGAAGTTVGAT-AATP------------GSEDWKAGA 216

  Fly    76 DDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTK 140
            |........|||:.||.||.:|:..||:.|:..:|||.::|..||..|.|||||:||||||||.|
  Rat   217 DSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNK 281

  Fly   141 WKRKYTSDVETL-ASHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMAS 204
            |||:..:::|.. .||..||              |:            ::..:|....|||..|:
  Rat   282 WKRQLAAELEAANLSHAAAQ--------------RI------------VRVPILYHENSAAEGAA 320

  Fly   205 ATTATGSPMRPYATSGGMPPLPGPSVMESARNAILARGQPLNFALPFGVAKPPAGGVP 262
            |  |.|:|:          |:..|.               |.|..|...:.|....||
  Rat   321 A--AAGAPV----------PVSQPL---------------LTFPHPVYYSHPVVSSVP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 20/74 (27%)
Homeobox 89..142 CDD:278475 29/52 (56%)
Hmx3NP_001099772.1 Homeobox 230..284 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.