DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and ind

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:194 Identity:59/194 - (30%)
Similarity:82/194 - (42%) Gaps:49/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PHSFSIEQILAKPEMRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDI-DLA 74
            |.||     ...|...||.|.:.:...:..:|......|..|  ..||.|.::...|..:| .|.
  Fly   163 PGSF-----CTSPSASSSASLDYTNNFDEPQGKRFKHESSCS--PNSSPLKNHSSGGPVEITPLI 220

  Fly    75 SDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRT 139
            :|..     |..||.||||::.|:..||.||....|||..:|..:|.:|:|:|.|:||||||||.
  Fly   221 NDYA-----DSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRV 280

  Fly   140 KWKRKYTSDVETLASHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMA 203
            |.|:                   ||              |::||......|   |||..|:|::
  Fly   281 KQKK-------------------GG--------------SESPTFNLSTNS---NGSPQASPVS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 21/73 (29%)
Homeobox 89..142 CDD:278475 27/52 (52%)
indNP_996087.2 Homeobox 231..283 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.