DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and VAX2

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_036608.1 Gene:VAX2 / 25806 HGNCID:12661 Length:290 Species:Homo sapiens


Alignment Length:235 Identity:74/235 - (31%)
Similarity:105/235 - (44%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DESGRGGNC--------------------LGASRASSPATS--SCLDDNMDDGKSDID-----LA 74
            :..|.||.|                    :..:.|||||.|  |..|.:...|..:.|     |.
Human    17 ESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGPGEADHCRRILV 81

  Fly    75 SDD---------GNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQI 130
            .|.         ..||..||.||.||:|:|.|:..||.||:|.:|:...:||.||:||.|:|||:
Human    82 RDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQV 146

  Fly   131 KIWFQNRRTKWKRKYTSDVETLASHYYAQ-LGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLN 194
            |:||||||||.|:..:.|:|..||...:: .....:.|.:..|..|    ..|..|:   .:.|.
Human   147 KVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLL----SVPRAPS---LLALT 204

  Fly   195 GSGSAAPMASATTATGSP------MRPYATSGGMPPLPGP 228
            .|....|.:...|:.|.|      :.|.:::...||||.|
Human   205 PSLPGLPASHRGTSLGDPRNSSPRLNPLSSASASPPLPPP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 30/104 (29%)
Homeobox 89..142 CDD:278475 30/52 (58%)
VAX2NP_036608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 13/57 (23%)
Homeobox 105..158 CDD:306543 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..240 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5115
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.