DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Lhx1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_665887.3 Gene:Lhx1 / 257634 RGDID:71074 Length:406 Species:Rattus norvegicus


Alignment Length:309 Identity:80/309 - (25%)
Similarity:117/309 - (37%) Gaps:54/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EDSVQDESGRGGNCL-GASRASSPATSSCLDDNMDDGKSDIDLAS----DDGNGLGDD-----RK 86
            ||.:.:.|....|.| .|:..|.|:.|....|...|...|.:.|:    :.|:...||     ::
  Rat   116 EDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR 180

  Fly    87 KRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVET 151
            :.|||...|.|::.|:..|......:...|..||::..|....|::||||||:|.:|  ...:..
  Rat   181 RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERR--MKQLSA 243

  Fly   152 LASHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPI----QSIMLNGSGS------AAPMASAT 206
            |.:..:|........||:|  |||......|.||...    ||......|:      ..|.:.|.
  Rat   244 LGARRHAFFRSPRRMRPLV--DRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQ 306

  Fly   207 TATGSPMRPYATSGGMP------PLPG--PSVMESARNAILARGQPLNFALPFGVAKPPAGGVP- 262
            |....|..|.:...|.|      ||||  ||........|||.        |.|.:..|...:| 
  Rat   307 TPVDLPFVPSSGPSGTPLGGLDHPLPGHHPSSEAQRFTDILAH--------PPGDSPSPEPSLPG 363

  Fly   263 -----AASYIPRCKPYATSYVDYAASLPTNESYLQMKYATLPPEAESGA 306
                 :|.......|:::..|:..||...:.|:        |||....|
  Rat   364 PLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSH--------PPEMNEAA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 21/82 (26%)
Homeobox 89..142 CDD:278475 19/52 (37%)
Lhx1NP_665887.3 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..189 16/60 (27%)
Homeobox 183..237 CDD:395001 19/53 (36%)
dnaA <263..>382 CDD:237605 31/126 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..372 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.