Sequence 1: | NP_001286635.1 | Gene: | lms / 37322 | FlyBaseID: | FBgn0034520 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508815.2 | Gene: | mls-2 / 180751 | WormBaseID: | WBGene00003377 | Length: | 341 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 68/202 - (33%) |
---|---|---|---|
Similarity: | 99/202 - (49%) | Gaps: | 36/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LAKPEMR-SSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGD 83
Fly 84 ---DRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKY 145
Fly 146 TSDVETLASHYYAQLGIGGLARPMVVGDRLWLFS--QTPTGPTPIQSIMLNGSG------SAAPM 202
Fly 203 -ASATTA 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lms | NP_001286635.1 | Cnd2 | 33..>106 | CDD:303063 | 24/75 (32%) |
Homeobox | 89..142 | CDD:278475 | 30/52 (58%) | ||
mls-2 | NP_508815.2 | Homeobox | 204..258 | CDD:395001 | 30/53 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 84 | 1.000 | Inparanoid score | I3757 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |