DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and mls-2

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_508815.2 Gene:mls-2 / 180751 WormBaseID:WBGene00003377 Length:341 Species:Caenorhabditis elegans


Alignment Length:202 Identity:68/202 - (33%)
Similarity:99/202 - (49%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAKPEMR-SSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGD 83
            ::.|::. .|.:.|:..:...|:.|.... |...||..|...||:      ||...|||.....|
 Worm   138 MSNPDVNIQSDNGEEKDEKSEGKDGETRD-STGGSPLESDAEDDD------DIGRGSDDEANSSD 195

  Fly    84 ---DRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKY 145
               :|||:.||.||.:|:..||..||..:|||..:|:.||::|.|||||:||||||||.|:||:.
 Worm   196 PSQNRKKKTRTVFSRSQVSQLEMMFECKRYLSSQERSNLAQKLHLTETQVKIWFQNRRNKFKRQA 260

  Fly   146 TSDVETLASHYYAQLGIGGLARPMVVGDRLWLFS--QTPTGPTPIQSIMLNGSG------SAAPM 202
            .:|...::...:                |..:||  .|....:||.:|....:|      .::||
 Worm   261 QTDDTNISLQMH----------------RANVFSIPATTALTSPILTIPTTSAGVNMRNMISSPM 309

  Fly   203 -ASATTA 208
             ||||.|
 Worm   310 DASATAA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 24/75 (32%)
Homeobox 89..142 CDD:278475 30/52 (58%)
mls-2NP_508815.2 Homeobox 204..258 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3757
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.