Sequence 1: | NP_001286635.1 | Gene: | lms / 37322 | FlyBaseID: | FBgn0034520 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023142.1 | Gene: | ceh-19 / 177590 | WormBaseID: | WBGene00000442 | Length: | 199 | Species: | Caenorhabditis elegans |
Alignment Length: | 265 | Identity: | 72/265 - (27%) |
---|---|---|---|
Similarity: | 104/265 - (39%) | Gaps: | 107/265 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SFSIEQILAKPE--MRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDID--- 72
Fly 73 -----------LASDDGNG--------LGDDRKK-------------RPRTAFSAAQIKALETEF 105
Fly 106 ERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGGLARPMV 170
Fly 171 VGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRPYATSGGMPPLPGPSVMESAR 235
Fly 236 NAILA 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lms | NP_001286635.1 | Cnd2 | 33..>106 | CDD:303063 | 21/107 (20%) |
Homeobox | 89..142 | CDD:278475 | 35/52 (67%) | ||
ceh-19 | NP_001023142.1 | Homeobox | 97..150 | CDD:278475 | 35/52 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |