DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and ceh-19

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001023142.1 Gene:ceh-19 / 177590 WormBaseID:WBGene00000442 Length:199 Species:Caenorhabditis elegans


Alignment Length:265 Identity:72/265 - (27%)
Similarity:104/265 - (39%) Gaps:107/265 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFSIEQILAKPE--MRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDID--- 72
            :|:||.:|.|..  :.....||:  :::|.:.|.                :|..::.|:.||   
 Worm     2 AFNIESLLEKKSNPVEEGNDFEE--ENDSEKNGE----------------EDEEEEEKNVIDGWT 48

  Fly    73 -----------LASDDGNG--------LGDDRKK-------------RPRTAFSAAQIKALETEF 105
                       :|:|....        ||...:|             :||.|:||.|:..|||||
 Worm    49 NMATSQLAMFAIANDLRTPTLVELQMLLGVSARKHDYKRSRKSVCERKPRQAYSARQLDRLETEF 113

  Fly   106 ERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGGLARPMV 170
            :..|||||.||..|::.|.|||||||.||||||||||::.||.:                 |.||
 Worm   114 QTDKYLSVNKRIQLSQTLNLTETQIKTWFQNRRTKWKKQLTSSI-----------------RQMV 161

  Fly   171 VGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRPYATSGGMPPLPGPSVMESAR 235
                    ...||                      :|:.|.|.:...|    ||.| |:.:....
 Worm   162 --------KDAPT----------------------STSVGVPFQSLLT----PPTP-PTTLACHV 191

  Fly   236 NAILA 240
            |::.|
 Worm   192 NSLFA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 21/107 (20%)
Homeobox 89..142 CDD:278475 35/52 (67%)
ceh-19NP_001023142.1 Homeobox 97..150 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.