DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Hoxd12

DIOPT Version :10

Sequence 1:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032300.2 Gene:Hoxd12 / 15432 MGIID:96204 Length:268 Species:Mus musculus


Alignment Length:87 Identity:31/87 - (35%)
Similarity:47/87 - (54%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAK 121
            :|||..::.||..         .|....|.::.|..::..||..||.||...::::..||..|:.
Mouse   180 ASCLRSSLPDGLP---------WGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSN 235

  Fly   122 QLQLTETQIKIWFQNRRTKWKR 143
            :|.|::.|:||||||||.|.||
Mouse   236 RLNLSDQQVKIWFQNRRMKKKR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 13/48 (27%)
Homeodomain 87..143 CDD:459649 22/55 (40%)
Hoxd12NP_032300.2 PHA03247 <37..123 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..124
Homeodomain 201..257 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.