DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Hoxd1

DIOPT Version :10

Sequence 1:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:55 Identity:30/55 - (54%)
Similarity:38/55 - (69%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRK 144
            ||.||..|:..||.||...|||:.|:|..:|..|||.:||:||||||||.|.|::
Mouse   233 RTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 8/15 (53%)
Homeodomain 87..143 CDD:459649 29/52 (56%)
Hoxd1NP_034597.2 PRK12323 <11..217 CDD:481241
Antp-type hexapeptide 204..209
Homeodomain 233..286 CDD:459649 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.