DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Hhex

DIOPT Version :10

Sequence 1:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:59 Identity:31/59 - (52%)
Similarity:39/59 - (66%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKR 143
            ::|..:..||..|...||.:||..||||..:|..|||.|||:|.|:|.||||||.||:|
Mouse   137 KRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 6/20 (30%)
Homeodomain 87..143 CDD:459649 30/55 (55%)