powered by:
Protein Alignment lms and ATHB54
DIOPT Version :9
Sequence 1: | NP_001286635.1 |
Gene: | lms / 37322 |
FlyBaseID: | FBgn0034520 |
Length: | 378 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001322131.1 |
Gene: | ATHB54 / 10723019 |
AraportID: | AT1G27045 |
Length: | 252 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 41/72 - (56%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 KKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTS-DV 149
|||..|.. |::.||..||..|.|...::..||::|.|..:|:.:||||||.::|.|... |.
plant 68 KKRKLTPI---QLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYKTKQLEHDC 129
Fly 150 ETLASHY 156
::|.:.|
plant 130 DSLKASY 136
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lms | NP_001286635.1 |
Cnd2 |
33..>106 |
CDD:303063 |
7/19 (37%) |
Homeobox |
89..142 |
CDD:278475 |
19/52 (37%) |
ATHB54 | NP_001322131.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.