DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Isl2

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006510819.1 Gene:Isl2 / 104360 MGIID:109156 Length:370 Species:Mus musculus


Alignment Length:90 Identity:22/90 - (24%)
Similarity:39/90 - (43%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSD 148
            ::..|.||..:..|:..|.|.:..........:..|.:...|:...|::||||:|.|.|:|....
Mouse   200 EKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILM 264

  Fly   149 VETLASHYYAQLGIGGL-ARPMVVG 172
            .:.....:..:..:.|| ..|:|.|
Mouse   265 KQLQQQQHSDKASLQGLTGTPLVAG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 6/21 (29%)
Homeobox 89..142 CDD:278475 14/52 (27%)
Isl2XP_006510819.1 LIM1_Isl 38..92 CDD:188752
LIM2_Isl2 100..154 CDD:188855
HOX 202..258 CDD:197696 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.