DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and Hoxa2

DIOPT Version :10

Sequence 1:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:11468112 Length:372 Species:Rattus norvegicus


Alignment Length:97 Identity:40/97 - (41%)
Similarity:56/97 - (57%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLS 112
            |:.::.||   ||..     |..:::|  ||:|.|   .:|.|||::..|:..||.||...|||.
  Rat   114 AAASTGPA---CLGH-----KESLEIA--DGSGGG---SRRLRTAYTNTQLLELEKEFHFNKYLC 165

  Fly   113 VAKRTALAKQLQLTETQIKIWFQNRRTKWKRK 144
            ..:|..:|..|.|||.|:|:||||||.|.||:
  Rat   166 RPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 19/57 (33%)
Homeodomain 87..143 CDD:459649 27/55 (49%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96
Antp-type hexapeptide 96..101
Homeodomain 140..196 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.