DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and vax1

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_031762281.1 Gene:vax1 / 100486982 XenbaseID:XB-GENE-478345 Length:293 Species:Xenopus tropicalis


Alignment Length:226 Identity:74/226 - (32%)
Similarity:109/226 - (48%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGRGGNCLGASRASSPATSSCLDDNMDDGKSDI-DLASDDGNGLGDDRKKRPRTAFSAAQIKALE 102
            ||....|..:..:|:.....|....:.|.|..| ::...  .||..||.||.||:|:|.|:..||
 Frog    53 SGSSEGCAKSKNSSAVDPEYCRRILVRDAKGSIREIILP--KGLDLDRPKRTRTSFTAEQLYRLE 115

  Fly   103 TEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVE--TLASHYYAQLGIGGL 165
            .||:|.:|:...:||.||:||.|:|||:|:||||||||.|:....|.|  ::.|...|...:   
 Frog   116 MEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSV--- 177

  Fly   166 ARPMVVGDRLWLFSQ----TPTGPTPIQSIMLNGSGSA--APMASATTA--TGSP-----MRPYA 217
                     |.|..|    :|.|   :..:|...:.:|  ||.:|..|:  ||:|     |.|..
 Frog   178 ---------LRLLEQGRLLSPPG---LPGLMPTCAPAALRAPSSSGATSLPTGAPLNQPRMHPSP 230

  Fly   218 TSGGMPPLPGPSVMESARNAILARGQPLNFA 248
            |...:..:|.||::.:..|.:.|  .||..|
 Frog   231 TGHNIFNMPVPSLLGTVANRLSA--NPLTMA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 22/67 (33%)
Homeobox 89..142 CDD:278475 30/52 (58%)
vax1XP_031762281.1 Homeobox 102..156 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5016
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.