Sequence 1: | NP_001286635.1 | Gene: | lms / 37322 | FlyBaseID: | FBgn0034520 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002937849.1 | Gene: | hmx2 / 100486800 | XenbaseID: | XB-GENE-480085 | Length: | 252 | Species: | Xenopus tropicalis |
Alignment Length: | 222 | Identity: | 74/222 - (33%) |
---|---|---|---|
Similarity: | 104/222 - (46%) | Gaps: | 52/222 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SFSIEQIL-----------AKPEMRS-----STSFEDSVQDESGRGGNC---------------- 45
Fly 46 -LGA----SRASSPATSSCLDDNMDDGKSDI-----DLASDDGNGLGDDRKKRPRTAFSAAQIKA 100
Fly 101 LETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETL-ASHYYAQLGIGG 164
Fly 165 LARPMVVGDRLWLFSQTPTG---PTPI 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lms | NP_001286635.1 | Cnd2 | 33..>106 | CDD:303063 | 27/98 (28%) |
Homeobox | 89..142 | CDD:278475 | 29/52 (56%) | ||
hmx2 | XP_002937849.1 | Homeobox | 132..186 | CDD:365835 | 30/53 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |