DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lms and hmx2

DIOPT Version :9

Sequence 1:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002937849.1 Gene:hmx2 / 100486800 XenbaseID:XB-GENE-480085 Length:252 Species:Xenopus tropicalis


Alignment Length:222 Identity:74/222 - (33%)
Similarity:104/222 - (46%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFSIEQIL-----------AKPEMRS-----STSFEDSVQDESGRGGNC---------------- 45
            ||:|:.||           |:...|.     |||.::..||||.||..|                
 Frog    17 SFTIQSILQGTTSDRGRTAARVYTREAISCPSTSSDEDEQDESWRGHGCNCPDPGDKDSKGQAPH 81

  Fly    46 -LGA----SRASSPATSSCLDDNMDDGKSDI-----DLASDDGNGLGDDRKKRPRTAFSAAQIKA 100
             .||    :|...|:.|.  .|..::..|..     |...|.|:.:|:. ||:.||.||.:|:..
 Frog    82 PCGAHRCPNRTQMPSPSQ--QDYTEEKDSHYPQSLGDRHKDGGDKMGNS-KKKTRTVFSRSQVYQ 143

  Fly   101 LETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETL-ASHYYAQLGIGG 164
            ||:.|:..:|||.::|..||..|||||||:|.||||||.||||:.::::|.. .:|..||..:| 
 Frog   144 LESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVG- 207

  Fly   165 LARPMVVGDRLWLFSQTPTG---PTPI 188
              .|:|..|...|....|..   |.|:
 Frog   208 --MPLVFRDNSILRVPVPRSIAFPAPL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 27/98 (28%)
Homeobox 89..142 CDD:278475 29/52 (56%)
hmx2XP_002937849.1 Homeobox 132..186 CDD:365835 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.