DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD82 and Tsp74F

DIOPT Version :9

Sequence 1:NP_002222.1 Gene:CD82 / 3732 HGNCID:6210 Length:267 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:122/253 - (48%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 CIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGA-YVFIGVGAVTML 68
            |.:..||.||:.|.:.|:.||::....:|.|.|:|....:|.|   :|..|| ||.:....:..|
  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGT---NLFSGAVYVLLVTSIIICL 71

Human    69 MGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSRE 133
            :.||||:||..||:|||..||..:.|:.:..:..|.|.|....:::|.|...:...:..|.|.||
  Fly    72 VSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRRE 136

Human   134 DSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNR----PEVTYPCSCEVKGEEDNSLSVRKGFCE 194
              :..|||..|.:::|||..::::|       ||    ||   .|..|:.|              
  Fly   137 --ITQAWDLTQERLQCCGVDTWHDW-------NRYGPVPE---SCCQELFG-------------- 175

Human   195 APGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICL 252
              |.|.:....|....:|.:||:.....:::::..:|.|..:.|||:.:.||:.| ||
  Fly   176 --GQRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFS-CL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD82NP_002222.1 Tetraspannin 24..256 CDD:278750 68/234 (29%)
CD37_CD82_like_LEL 106..229 CDD:239413 28/126 (22%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.