DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and GAL4

DIOPT Version :9

Sequence 1:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_015076.1 Gene:GAL4 / 855828 SGDID:S000006169 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:124 Identity:27/124 - (21%)
Similarity:44/124 - (35%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PQLSHKLEDSAAVQ-AAKQRHFAAYNRIAQEHANH------TPGQVALANAPHASAAVAHATQKH 143
            |.:|:...:.:|:: .......|.|..:.:|:.|:      :||.|..:..|..|.|......|.
Yeast   655 PHISYNNSNGSAIKNIVGSATIAQYPTLPEENVNNISVKYVSPGSVGPSPVPLKSGASFSDLVKL 719

  Fly   144 LS----------AFERIAAEHAAI----GRQQEAQRLALAAQS---------EHGEIED 179
            ||          ...|....|.::    |:||:.|.|.....|         :.|.|.|
Yeast   720 LSNRPPSRNSPVTIPRSTPSHRSVTPFLGQQQQLQSLVPLTPSALFGGANFNQSGNIAD 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791
GAL4NP_015076.1 Zn_clus 9..47 CDD:395120
ZIP_Gal4 50..95 CDD:271238
coiled coil 52..73 CDD:271238
fungal_TF_MHR 236..643 CDD:213391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.924933 Normalized mean entropy S1795
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.