DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and ADA2

DIOPT Version :9

Sequence 1:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_010736.3 Gene:ADA2 / 852059 SGDID:S000002856 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:45/220 - (20%)
Similarity:66/220 - (30%) Gaps:65/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PEPKVPASPYVFSYQAGR----------APGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQY 77
            |...||:...|..:..||          |.|.|.....|..|....|...|:.:|..|...|.:.
Yeast   152 PMASVPSCHEVQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIELKFAILDIYNSRLTTRA 216

  Fly    78 VADEHGFHPQLS--HKLE--DSAAVQAAKQRHFAAYNRI--------AQEHANHTPGQVALANAP 130
            ......|...|.  .||:  |....:.||:    .||||        ||:....:..   :....
Yeast   217 EKKRLLFENHLMDYRKLQAIDKKRSKEAKE----LYNRIKPFARVMTAQDFEEFSKD---ILEEL 274

  Fly   131 HASAAVAHA--------------------TQKHLSAFERIAAEHAAI---GRQQEAQRLALAAQS 172
            |..|.:...                    .|..:|:||:..|..||.   |..:.....|..:.:
Yeast   275 HCRARIQQLQEWRSNGLTTLEAGLKYERDKQARISSFEKFGASTAASLSEGNSRYRSNSAHRSNA 339

  Fly   173 EHGE-------------IEDGQYHP 184
            |:.:             |.|.|:.|
Yeast   340 EYSQNYSENGGRKKNMTISDIQHAP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 13/61 (21%)
ADA2NP_010736.3 COG5114 3..434 CDD:227445 45/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.924933 Normalized mean entropy S1795
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.