DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:100 Identity:31/100 - (31%)
Similarity:49/100 - (49%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIVLVVCLLAVA----AADVSHLVTPEPKVPASPYVFSY-------QAGRAPGHVDRQHTEVSDG 55
            |:::.|.|.|||    ||:...:|..|..|  .|..|.|       ||.:|.|.::...||....
  Fly     3 FLIVFVALFAVALAAPAAEEPTIVRSESDV--GPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65

  Fly    56 SGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
            |  :.|::.::....|...|.|:||::||.|:.:|
  Fly    66 S--VSGSYRFIADDGQTYQVNYIADKNGFQPEGAH 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 15/58 (26%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 15/56 (27%)

Return to query results.
Submit another query.